Senllen Car Tent Fully Automatic 189 inch Large Size Hot Summer Anti-UV Wireless Control Vehicle Umbrella with Removable Charger, Windproof Carport Canopy Sun Shade for SUV, Minivan, Truck
$269.00
Features
Details
rdugheSeereFuyum-revurysubeghehehssummer!Whug-edgeumfdedsruuredwreessremer,hsrgeSzerUmbreprvdesveedeegshdefryurSUV,mv,rruk.SygdbyehesweergheshePUsveredmerhepsmerremperuref95°Fevehehessummerdys.Preyurvehefrmsw,rus,dr,dmrewhhshgh-quy,wdprfrprpy.
Whemesseury,rusheSeere!Desgedwhsxdjusbewdprfrpesddurbefrme,hsrumbreesuresmxmumsbydprefryurvehe.hevveu-muswhwsfresyper,gvgyuhefexbydphggweherds.Ejyhepeefmdkwgyurrsshededfrmhrsheemeswhemgsyshdprsurpre.
See,weremmedyurssfdprvde90-dyfurefudgureed15mhsfusmersuppr.Expereeheveeedrebyfurumredy,dkehefrssepwrdskeepgyurvehesfedhrughuheyer.D'ebdweherruyurr-vesheSeereFuyumw!
Discover More Best Sellers in Carports
Shop Carports
Carports - COCONUT Sun Sail Canopy 8 X 10 Ft Heavy Duty Shade Cloth Outdoor Patio Cover UV Block Sunshade Fabric Awning Shelter for Deck Carport Pool Garden, 8' x 10' Rectangle, Sand
Caravan Canopy D2C20011 Domain Shelters Pro 200 10' x 20' Carport, Upgraded Version, White
$179.69
Carports - Caravan Canopy D2C20011 Domain Shelters Pro 200 10' x 20' Carport, Upgraded Version, White
$64.18
Carports - Impact Canopy Roller Bag for Carport Canopy Tent, Wheeled Storage Bag with Handles, Fits 10 x 20 Portable Carport Canopy - Roller Bag Only
$359.98
Carports - ADVANCE OUTDOOR 12x20 ft Heavy Duty Carport Car Canopy Garage Boat Shelter Party Tent, Adjustable Peak Height from 9.5ft to 11ft, Green
$98.50
Carports - BenefitUSA Carport Side Wall for 10x20 Tent Garage, Replacement Canopy Sidewall White (Side Wall ONLY, Frame NOT Included)
$369.99
Carports - Carport 10x20ft Car Canopy with Transparent Roll-up Windows, Removable Sidewalls & Doors,Portable Garage for Car, Truck, Boat, Car Canopy, Grey
$209.99
Carports - Outsunny 10' x 20' Heavy Duty Carport, Portable Garage & Patio Canopy Tent Storage Shelter, 8.7'-10.2' Adjustable Height, Anti-UV Cover for Car, Truck, Boat, Catering, Wedding, Beige
$249.99
Carports - JAMFLY Carport, 10x20 ft Heavy Duty Carport Canopy with Roll-up Windows, Portable Garage with Removable Sidewalls & Doors, Car Canopy with All-Season Tarp for Car, Truck, Boat
$519.99
Carports - MELLCOM Portable Garage, 12' x 20' x 9.8' Heavy Duty Carport with All-Steel Metal Frame and Round Style Roof, Anti-Snow Car Canopy for Car, Truck, Boat

